PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00109864001
Common NameGSBRNA2T00109864001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 274aa    MW: 30997.9 Da    PI: 8.5524
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00109864001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.23.7e-3852112262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++k+++cprC+s++tkfCyynny+++qPr+fCkaC+ryWt GG++r vPvG+grrknk++s
  GSBRNA2T00109864001  52 PTKIIPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRYWTSGGTMRSVPVGAGRRKNKNNS 112
                          67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3538106IPR003851Zinc finger, Dof-type
PfamPF027012.9E-3155110IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.2256110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105894IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MQESKDQEIK LFGMKIHLST VLEAEEDGIS AEKNQKETLT DQVEKDKTLK KPTKIIPCPR  60
CNSMETKFCY YNNYNVNQPR HFCKACQRYW TSGGTMRSVP VGAGRRKNKN NSSSSSHNYQ  120
HATISETDGP VLNFTHGDDQ KVSDNRLMHS WPYMWNPGFY PVYPYWNVPM LSSSPNSSPN  180
STLGKHSRDE DETIMPKQSY GSVLVPKTLR VDDPNEAAKS SIWTTLGIKN EVMFKGFDSK  240
KEVKISKEET ETSLVLCANP AALSRSANFH ERL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00109864001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895971e-138AC189597.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH014E13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009151365.10.0PREDICTED: cyclic dof factor 1
SwissprotQ8W1E31e-146CDF1_ARATH; Cyclic dof factor 1
TrEMBLA0A078EGP30.0A0A078EGP3_BRANA; BnaA06g21870D protein
STRINGBra010082.1-P1e-178(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139791625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.11e-141cycling DOF factor 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]